undulate
Timing diagram generator
A Python-based tool for generating digital timing diagrams in various formats
35 stars
4 watching
1 forks
Language: Python
last commit: 9 months ago
Linked from 1 awesome list
digital-timing-diagramsepsjsonpdfpngsvgtiming-diagramwavedromwaveform
Related projects:
Repository | Description | Stars |
---|---|---|
| Generates SVG timelines from simple JSON input. | 461 |
| A Python clone of Labella.js for generating SVG and TikZ PDF output | 66 |
| A Python library to generate diagrams in various formats from structured data | 157 |
| A tool to convert 5G protocol traces into visual sequence diagrams | 274 |
| A framework for creating timelines from log data to support forensic analysis | 1,745 |
| A typst template for generating timetables with features like collision detection and automatic extension. | 86 |
| A Python toolkit for generating human-readable timetables from GTFS data | 40 |
| Tools for generating WaveDrom diagrams from Python. | 98 |
| Creates a Github timeline in Common Lisp using ningle | 14 |
| A CLI tool for generating ERD diagrams from DuckDB databases | 78 |
| Generates graphs on the Golem Network to visualize wave pair dynamics | 1 |
| An open-source implementation of a graph neural network architecture for scene graph generation in computer vision | 121 |
| Generates time-lapse videos from text inputs using deep learning models. | 1,312 |
| Tools for generating documentation and JSON dumps from Protocol Buffers files | 167 |
| A tool for generating API documentation from Python code | 1,982 |