 undulate
 undulate 
 Timing diagram generator
 A Python-based tool for generating digital timing diagrams in various formats
35 stars
 4 watching
 1 forks
 
Language: Python 
last commit: about 1 year ago 
Linked from   1 awesome list  
  digital-timing-diagramsepsjsonpdfpngsvgtiming-diagramwavedromwaveform 
 Related projects:
| Repository | Description | Stars | 
|---|---|---|
|  | Generates SVG timelines from simple JSON input. | 461 | 
|  | A Python clone of Labella.js for generating SVG and TikZ PDF output | 66 | 
|  | A Python library to generate diagrams in various formats from structured data | 157 | 
|  | A tool to convert 5G protocol traces into visual sequence diagrams | 274 | 
|  | A framework for creating timelines from log data to support forensic analysis | 1,745 | 
|  | A typst template for generating timetables with features like collision detection and automatic extension. | 86 | 
|  | A Python toolkit for generating human-readable timetables from GTFS data | 40 | 
|  | Tools for generating WaveDrom diagrams from Python. | 98 | 
|  | Creates a Github timeline in Common Lisp using ningle | 14 | 
|  | A CLI tool for generating ERD diagrams from DuckDB databases | 78 | 
|  | Generates graphs on the Golem Network to visualize wave pair dynamics | 1 | 
|  | An open-source implementation of a graph neural network architecture for scene graph generation in computer vision | 121 | 
|  | Generates time-lapse videos from text inputs using deep learning models. | 1,312 | 
|  | Tools for generating documentation and JSON dumps from Protocol Buffers files | 167 | 
|  | A tool for generating API documentation from Python code | 1,982 |