undulate
Timing diagram generator
A Python-based tool for generating digital timing diagrams in various formats
35 stars
4 watching
1 forks
Language: Python
last commit: about 2 years agoLinked from 1 awesome list
digital-timing-diagramsepsjsonpdfpngsvgtiming-diagramwavedromwaveform
Related projects:
| Repository | Description | Stars |
|---|---|---|
| Generates SVG timelines from simple JSON input. | 461 | |
| A Python clone of Labella.js for generating SVG and TikZ PDF output | 66 | |
| A Python library to generate diagrams in various formats from structured data | 157 | |
| A tool to convert 5G protocol traces into visual sequence diagrams | 274 | |
| A framework for creating timelines from log data to support forensic analysis | 1,745 | |
| A typst template for generating timetables with features like collision detection and automatic extension. | 86 | |
| A Python toolkit for generating human-readable timetables from GTFS data | 40 | |
| Tools for generating WaveDrom diagrams from Python. | 98 | |
| Creates a Github timeline in Common Lisp using ningle | 14 | |
| A CLI tool for generating ERD diagrams from DuckDB databases | 78 | |
| Generates graphs on the Golem Network to visualize wave pair dynamics | 1 | |
| An open-source implementation of a graph neural network architecture for scene graph generation in computer vision | 121 | |
| Generates time-lapse videos from text inputs using deep learning models. | 1,312 | |
| Tools for generating documentation and JSON dumps from Protocol Buffers files | 167 | |
| A tool for generating API documentation from Python code | 1,982 |