kitsu
JSON client library
A lightweight JSON-API client with framework-agnostic serialization components
🦊 A simple, lightweight & framework agnostic JSON:API client
274 stars
8 watching
42 forks
Language: JavaScript
last commit: over 1 year ago
Linked from 1 awesome list
api-clientasyncasync-awaitecmascriptesmhacktoberfestjavascriptjson-apijson-api-serializerkitsukitsu-apikitsu-ionodejsnpmpromise
Related projects:
| Repository | Description | Stars |
|---|---|---|
| | A lightweight Java library for working with JSON data structures | 84 |
| | A .NET library for building high-performance REST API clients with features like semantic declaration, aspect-oriented programming, and Swagger-to-code support. | 2,062 |
| | A framework for interacting with JSONAPI services from .NET applications | 6 |
| | A Swift framework for creating and sending HTTP requests using async/await | 946 |
| | Provides a Simple JSON-RPC 2.0 middleware for Python-based APIs | 5 |
| | A Vlang wrapper around cJSON for working with JSON data structures and serialization. | 11 |
| | A demo application showcasing integration of JsonApiDotNetCore with Ember.js | 8 |
| | A JSON:API framework for F# domain models allowing developers to expose their logic as an API with minimal boilerplate | 78 |
| | A JSON API server written in Haskell demonstrating real-world use of hasql and scotty. | 66 |
| | An iOS and macOS library for interacting with the VK API using Swift | 256 |
| | A terminal HTTP API client for scripting and processing API output | 603 |
| | A lightweight JSON serialization and deserialization library for .NET | 382 |
| | A terminal-based API client for making HTTP requests | 2,073 |
| | A lightweight C++ JSON library with intuitive syntax and minimal dependencies | 1 |
| | A Django extension that adds support for JSON:API format to Django REST framework | 1,198 |