kitsu

JSON client library

A lightweight JSON-API client with framework-agnostic serialization components

🦊 A simple, lightweight & framework agnostic JSON:API client

GitHub

274 stars
8 watching
42 forks
Language: JavaScript
last commit: over 1 year ago
Linked from 1 awesome list

api-clientasyncasync-awaitecmascriptesmhacktoberfestjavascriptjson-apijson-api-serializerkitsukitsu-apikitsu-ionodejsnpmpromise

Backlinks from these awesome lists:

Related projects:

Repository Description Stars
bolerio/mjson A lightweight Java library for working with JSON data structures 84
dotnetcore/webapiclient A .NET library for building high-performance REST API clients with features like semantic declaration, aspect-oriented programming, and Swagger-to-code support. 2,062
oktaykir/jsonapi-consumer A framework for interacting with JSONAPI services from .NET applications 6
kean/get A Swift framework for creating and sending HTTP requests using async/await 946
zcattacz/ujrpc Provides a Simple JSON-RPC 2.0 middleware for Python-based APIs 5
lydiandy/cjson A Vlang wrapper around cJSON for working with JSON data structures and serialization. 11
json-api-dotnet/todolistexample A demo application showcasing integration of JsonApiDotNetCore with Ember.js 8
cmeeren/felicity A JSON:API framework for F# domain models allowing developers to expose their logic as an API with minimal boilerplate 78
bendyworks/api-server A JSON API server written in Haskell demonstrating real-world use of hasql and scotty. 66
swiftyvk/swiftyvk An iOS and macOS library for interacting with the VK API using Swift 256
jonaslu/ain A terminal HTTP API client for scripting and processing API output 603
facebook-csharp-sdk/simple-json A lightweight JSON serialization and deserialization library for .NET 382
julien-cpsn/atac A terminal-based API client for making HTTP requests 2,073
kassane/json A lightweight C++ JSON library with intuitive syntax and minimal dependencies 1
django-json-api/django-rest-framework-json-api A Django extension that adds support for JSON:API format to Django REST framework 1,198