kitsu
JSON client library
A lightweight JSON-API client with framework-agnostic serialization components
🦊 A simple, lightweight & framework agnostic JSON:API client
273 stars
8 watching
41 forks
Language: JavaScript
last commit: 4 days ago
Linked from 1 awesome list
api-clientasyncasync-awaitecmascriptesmhacktoberfestjavascriptjson-apijson-api-serializerkitsukitsu-apikitsu-ionodejsnpmpromise
talentlessguy/awesome-node-esmRelated projects:
| Repository | Description | Stars |
|---|---|---|
 bolerio/mjson | A lightweight Java library for working with JSON data structures | 83 |
 dotnetcore/webapiclient | A .NET library for building high-performance REST API clients with features like semantic declaration, aspect-oriented programming, and Swagger-to-code support. | 2,053 |
 oktaykir/jsonapi-consumer | A framework for interacting with JSONAPI services from .NET applications | 6 |
 kean/get | A Swift framework for creating and sending HTTP requests using async/await | 943 |
 zcattacz/ujrpc | Provides a Simple JSON-RPC 2.0 middleware for Python-based APIs | 5 |
 lydiandy/cjson | A Vlang wrapper around cJSON for working with JSON data structures and serialization. | 11 |
 json-api-dotnet/todolistexample | A demo application showcasing integration of JsonApiDotNetCore with Ember.js | 8 |
 cmeeren/felicity | A JSON:API framework for F# domain models allowing developers to expose their logic as an API with minimal boilerplate | 77 |
 bendyworks/api-server | A JSON API server written in Haskell demonstrating real-world use of hasql and scotty. | 66 |
 swiftyvk/swiftyvk | An iOS and macOS library for interacting with the VK API using Swift | 256 |
 jonaslu/ain | A terminal HTTP API client that enables scripting and further processing of API output via pipes | 602 |
 facebook-csharp-sdk/simple-json | A lightweight JSON serialization and deserialization library for .NET | 380 |
 julien-cpsn/atac | A terminal-based API client for making HTTP requests | 2,017 |
 kassane/json | A lightweight C++ JSON library with intuitive syntax and minimal dependencies | 1 |
 django-json-api/django-rest-framework-json-api | A Django extension that adds support for JSON:API format to Django REST framework | 1,193 |