warp
Smart contract platform
An implementation of the Arweave SmartWeave smart contracts protocol for creating and interacting with blockchain-based smart contract applications.
An implementation of the Arweave SmartWeave smart contracts protocol.
159 stars
5 watching
44 forks
Language: JavaScript
last commit: 5 months ago
Linked from 1 awesome list
arweaverustsmart-contractssmartweavetypescriptwasm
Related projects:
Repository | Description | Stars |
---|---|---|
| Provides pre-built templates and tools for developing and deploying smart contracts in various programming languages on the SmartWeave Protocol | 41 |
| Enables users to create, deploy, and interact with scalable smart contracts on the Arweave protocol using a simple CLI interface. | 251 |
| Smart contracts and signatures for swapping on the Algorand blockchain, supporting multiple types of swaps. | 30 |
| An abstraction layer for Ethereum smart contracts with flexible configuration options and simple integration | 26 |
| An online IDE for creating and deploying smart contracts on the Arweave network using the Smartweave protocol. | 17 |
| Simplifies interactions with Substrate-based networks and ink! smart contracts using React hooks and utility functions | 50 |
| A sandbox environment for developing, testing and debugging smart contracts on the Substrate blockchain | 77 |
| A collection of concise Solidity smart contract examples for educational purposes and quick reference. | 2 |
| Provides storage abstractions for CosmWasm smart contracts | 38 |
| A tool for building and interacting with smart contracts on the Ethereum network | 906 |
| A preprocessor and flattener for Ethereum's Solidity source files | 112 |
| A template for developing EVM-based smart contracts in TypeScript | 491 |
| A CLI tool that generates JavaScript modules from Solidity contracts for interacting with decentralized applications. | 41 |
| Periphery smart contracts for interacting with the Uniswap V3 Protocol | 1,213 |
| A Wasm smart contract platform built on Polkadot's Substrate framework | 54 |