warp
Smart contract platform
An implementation of the Arweave SmartWeave smart contracts protocol for creating and interacting with blockchain-based smart contract applications.
An implementation of the Arweave SmartWeave smart contracts protocol.
159 stars
5 watching
44 forks
Language: JavaScript
last commit: 17 days ago
Linked from 1 awesome list
arweaverustsmart-contractssmartweavetypescriptwasm
bitruss/awesome-arweaveRelated projects:
| Repository | Description | Stars |
|---|---|---|
| warp-contracts/warp-wasm-templates | Provides pre-built templates and tools for developing and deploying smart contracts in various programming languages on the SmartWeave Protocol | 41 |
 arweaveteam/smartweave | Enables users to create, deploy, and interact with scalable smart contracts on the Arweave protocol using a simple CLI interface. | 250 |
 algoworldnft/algoworld-contracts | Smart contracts and signatures for swapping on the Algorand blockchain, supporting multiple types of swaps. | 30 |
 merklejerk/flex-contract | An abstraction layer for Ethereum smart contracts with flexible configuration options and simple integration | 26 |
 luckyr13/arcode | An online IDE for creating and deploying smart contracts on the Arweave network using the Smartweave protocol. | 17 |
 scio-labs/use-inkathon | Simplifies interactions with Substrate-based networks and ink! smart contracts using React hooks and utility functions | 50 |
 patractlabs/europa | A sandbox environment for developing, testing and debugging smart contracts on the Substrate blockchain | 77 |
 rohitroy-github/smart-contract-snippets | A collection of concise Solidity smart contract examples for educational purposes and quick reference. | 2 |
 cosmwasm/cw-storage-plus | Provides storage abstractions for CosmWasm smart contracts | 37 |
 apeworx/ape | A Web3 development tool for compiling, testing, and interacting with smart contracts | 892 |
| merklejerk/solpp | A preprocessor and flattener for Ethereum's Solidity source files | 112 |
 wighawag/template-ethereum-contracts | A template for developing EVM-based smart contracts in TypeScript | 489 |
 okwme/dapp-scratch | A CLI tool that generates JavaScript modules from Solidity contracts for interacting with decentralized applications. | 41 |
 uniswap/v3-periphery | Periphery smart contracts for interacting with the Uniswap V3 Protocol | 1,198 |
| patractlabs/jupiter | A Wasm smart contract platform built on Polkadot's Substrate framework | 54 |