warp

Smart contract platform

An implementation of the Arweave SmartWeave smart contracts protocol for creating and interacting with blockchain-based smart contract applications.

An implementation of the Arweave SmartWeave smart contracts protocol.

GitHub

159 stars
5 watching
44 forks
Language: JavaScript
last commit: 8 months ago
Linked from 1 awesome list

arweaverustsmart-contractssmartweavetypescriptwasm

Backlinks from these awesome lists:

Related projects:

Repository Description Stars
warp-contracts/warp-wasm-templates Provides pre-built templates and tools for developing and deploying smart contracts in various programming languages on the SmartWeave Protocol 41
arweaveteam/smartweave Enables users to create, deploy, and interact with scalable smart contracts on the Arweave protocol using a simple CLI interface. 251
algoworldnft/algoworld-contracts Smart contracts and signatures for swapping on the Algorand blockchain, supporting multiple types of swaps. 30
merklejerk/flex-contract An abstraction layer for Ethereum smart contracts with flexible configuration options and simple integration 26
luckyr13/arcode An online IDE for creating and deploying smart contracts on the Arweave network using the Smartweave protocol. 17
scio-labs/use-inkathon Simplifies interactions with Substrate-based networks and ink! smart contracts using React hooks and utility functions 50
patractlabs/europa A sandbox environment for developing, testing and debugging smart contracts on the Substrate blockchain 77
rohitroy-github/smart-contract-snippets A collection of concise Solidity smart contract examples for educational purposes and quick reference. 2
cosmwasm/cw-storage-plus Provides storage abstractions for CosmWasm smart contracts 38
apeworx/ape A tool for building and interacting with smart contracts on the Ethereum network 906
merklejerk/solpp A preprocessor and flattener for Ethereum's Solidity source files 112
wighawag/template-ethereum-contracts A template for developing EVM-based smart contracts in TypeScript 491
okwme/dapp-scratch A CLI tool that generates JavaScript modules from Solidity contracts for interacting with decentralized applications. 41
uniswap/v3-periphery Periphery smart contracts for interacting with the Uniswap V3 Protocol 1,213
patractlabs/jupiter A Wasm smart contract platform built on Polkadot's Substrate framework 54