mkdkr
Pipeline builder
A framework that allows developers to build and run CI/CD pipelines using a Makefile and Docker, with support for various pipeline engines.
mkdkr = Makefile + Docker
369 stars
7 watching
21 forks
Language: Shell
last commit: over 3 years ago
Linked from 2 awesome lists
bashcirlecidockergithub-actionsgitlab-cijenkinsmakefilepipelinestravis-ci
alebcay/awesome-shell
awesome-lists/awesome-bashRelated projects:
| Repository | Description | Stars |
|---|---|---|
 kinto-b/makepipe | A tool for constructing simple pipelines in R with minimal overheads. | 30 |
 kirillseva/ruigi | A tool for designing and managing data processing pipelines in R. | 42 |
 druths/xp | A tool for creating flexible and self-documenting data science pipelines | 56 |
 ropensci/targets | A tool for creating reproducible data science pipelines in R. | 940 |
 ramblingcookiemonster/buildhelpers | A collection of helper functions for automating tasks in PowerShell CI/CD pipelines | 215 |
 kubeflow-kale/kale | Simplifies the deployment of Kubeflow Pipelines workflows by providing a graphical interface for Data Scientists to define and deploy pipelines directly from JupyterLab. | 632 |
 m3dev/gokart | A framework that solves common problems in machine learning pipeline development and provides an environment for reproducibility and team collaboration. | 318 |
 fluidattacks/makes | A framework for building and managing CI/CD pipelines and application environments with cryptographic signed dependencies. | 453 |
 minyus/pipelinex | A Python package to build and experiment with machine learning pipelines using Kedro, MLflow, and other tools | 224 |
 robdmc/consecution | A simple pipeline abstraction for building data processing workflows with Python | 168 |
 vmchale/cpkg | A build tool and package manager for C languages with cross-compilation support | 68 |
 zorbash/opus | A framework for building pluggable business logic pipelines with a focus on modular and composable components. | 361 |
 destel/rill | A toolkit for building concurrent programs by composing simple, reusable parts into clean pipelines. | 510 |
 chevdor/srtool-cli | A command-line tool to simplify the use of the srtool Docker image for building Substrate runtime environments. | 18 |
 kcmvp/gob | Solves the problem of repetitive initialization process when starting new Golang projects by providing a tool and framework for efficient project setup and management. | 11 |