mkdkr

Pipeline builder

A framework that allows developers to build and run CI/CD pipelines using a Makefile and Docker, with support for various pipeline engines.

mkdkr = Makefile + Docker

GitHub

370 stars
7 watching
21 forks
Language: Shell
last commit: almost 5 years ago
Linked from 2 awesome lists

bashcirlecidockergithub-actionsgitlab-cijenkinsmakefilepipelinestravis-ci

Backlinks from these awesome lists:

Related projects:

Repository Description Stars
kinto-b/makepipe A tool for constructing simple pipelines in R with minimal overheads. 31
kirillseva/ruigi A tool for designing and managing data processing pipelines in R. 42
druths/xp A tool for creating flexible and self-documenting data science pipelines 56
ropensci/targets A tool for creating reproducible data science pipelines in R. 949
ramblingcookiemonster/buildhelpers A collection of helper functions for automating tasks in PowerShell CI/CD pipelines 216
kubeflow-kale/kale Simplifies the deployment of Kubeflow Pipelines workflows by providing a graphical interface for Data Scientists to define and deploy pipelines directly from JupyterLab. 632
m3dev/gokart A framework that solves common problems in machine learning pipeline development and provides an environment for reproducibility and team collaboration. 319
fluidattacks/makes A framework for building and managing CI/CD pipelines and application environments with cryptographic signed dependencies. 461
minyus/pipelinex A Python package to build and experiment with machine learning pipelines using Kedro, MLflow, and other tools 226
robdmc/consecution A simple pipeline abstraction for building data processing workflows with Python 169
vmchale/cpkg A build tool and package manager for C languages with cross-compilation support 68
zorbash/opus A framework for building pluggable business logic pipelines with a focus on modular and composable components. 362
destel/rill A toolkit that simplifies concurrency in Go by providing a composable and clean way to handle channels and errors. 1,440
chevdor/srtool-cli A command-line tool to simplify the use of the srtool Docker image for building Substrate runtime environments. 18
kcmvp/gob Solves the problem of repetitive initialization process when starting new Golang projects by providing a tool and framework for efficient project setup and management. 11