mkdkr
Pipeline builder
A framework that allows developers to build and run CI/CD pipelines using a Makefile and Docker, with support for various pipeline engines.
mkdkr = Makefile + Docker
370 stars
7 watching
21 forks
Language: Shell
last commit: over 4 years ago
Linked from 2 awesome lists
bashcirlecidockergithub-actionsgitlab-cijenkinsmakefilepipelinestravis-ci
Related projects:
Repository | Description | Stars |
---|---|---|
| A tool for constructing simple pipelines in R with minimal overheads. | 31 |
| A tool for designing and managing data processing pipelines in R. | 42 |
| A tool for creating flexible and self-documenting data science pipelines | 56 |
| A tool for creating reproducible data science pipelines in R. | 949 |
| A collection of helper functions for automating tasks in PowerShell CI/CD pipelines | 216 |
| Simplifies the deployment of Kubeflow Pipelines workflows by providing a graphical interface for Data Scientists to define and deploy pipelines directly from JupyterLab. | 632 |
| A framework that solves common problems in machine learning pipeline development and provides an environment for reproducibility and team collaboration. | 319 |
| A framework for building and managing CI/CD pipelines and application environments with cryptographic signed dependencies. | 461 |
| A Python package to build and experiment with machine learning pipelines using Kedro, MLflow, and other tools | 226 |
| A simple pipeline abstraction for building data processing workflows with Python | 169 |
| A build tool and package manager for C languages with cross-compilation support | 68 |
| A framework for building pluggable business logic pipelines with a focus on modular and composable components. | 362 |
| A toolkit that simplifies concurrency in Go by providing a composable and clean way to handle channels and errors. | 1,440 |
| A command-line tool to simplify the use of the srtool Docker image for building Substrate runtime environments. | 18 |
| Solves the problem of repetitive initialization process when starting new Golang projects by providing a tool and framework for efficient project setup and management. | 11 |