Practical-Cryptography-for-Developers-Book
Cryptography book
A comprehensive guide to cryptography and secure coding practices for software developers
Practical Cryptography for Developers: Hashes, MAC, Key Derivation, DHKE, Symmetric and Asymmetric Ciphers, Public Key Cryptosystems, RSA, Elliptic Curves, ECC, secp256k1, ECDH, ECIES, Digital Signatures, ECDSA, EdDSA
3k stars
133 watching
422 forks
Language: CSS
last commit: 6 months ago
Linked from 1 awesome list
aesasymmetric-ciphersbookcryptographydigital-signatureeccecdhelliptic-curveselliptic-curves-cryptographyhasheshmackdfkey-agreementprogrammingpublic-key-cryptographypythonquantum-safe-cryptographytutorial
arpitingle/library-of-ethereumRelated projects:
| Repository | Description | Stars |
|---|---|---|
 21-dot-dev/swift-secp256k1 | Provides cryptographic primitives and signatures for Bitcoin-based systems | 111 |
 q9f/secp256k1.cr | A native Crystal language implementation of the Secp256k1 elliptic curve cryptographic algorithm | 48 |
 fallibleinc/security-guide-for-developers | A comprehensive security guide for developers to help create more secure systems | 20,923 |
 ektrah/nsec | A cryptographic library for .NET based on libsodium | 394 |
 aldy505/phc-crypto | Provides a simplified interface to multiple hashing algorithms | 26 |
 paulmillr/noble-secp256k1 | A high-performance JavaScript implementation of secp256k1 signatures and ECDH (Elliptic Curve Diffie-Hellman) algorithms | 761 |
 pyca/cryptography | A package providing cryptographic primitives and recipes for secure data encryption and manipulation | 6,681 |
 weidai11/cryptopp | A comprehensive C++ class library providing various cryptographic schemes and algorithms. | 4,895 |
 b-con/crypto-algorithms | Public domain implementations of basic cryptography algorithms for educational and pragmatic purposes. | 1,832 |
 akuradiary/sigma_ciphers_cryptograms | A Python implementation of various ciphers and encryption algorithms with a custom wrapper called Sigma. | 3 |
 sdrapkin/securitydriven.inferno | A .NET cryptography library providing a secure and reliable implementation of encryption algorithms | 569 |
 mratsim/constantine | A high-performance cryptography library for cryptographic primitives and protocols used in blockchain and zero-knowledge proof systems | 408 |
 azadkuh/mbedcrypto | A portable C++ library for encryption and decryption of binary data using various algorithms | 47 |
 pubkey/eth-crypto | Provides cryptographic functions for Ethereum transactions and smart contracts | 878 |
 jangko/nimaes | An implementation of the Advanced Encryption Standard with the Rinjdael algorithm in Nim. | 54 |